missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TRAPPC11 Rabbit anti-Human, Polyclonal, Novus Biologicals™

TRAPPC11 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18391535 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18391535 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Produktkod. 18391535 Leverantör Novus Biologicals Leverantörsnummer NBP310060100UL

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit Polyclonal Antibody

TRAPPC11 Polyclonal specifically detects TRAPPC11 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen TRAPPC11
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias foigr, C4orf41, chromosome 4 open reading frame 41, gry, trafficking protein particle complex 11, TRAPPC11
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human C4ORF41 (NP_068761.4). Peptide sequence KGILKTGWMNKHLNLVPALVVVFYELDWDEPQWKEKQSECATRVEIVRQS
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 60684
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.