missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TRAPPC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | TRAPPC1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TRAPPC1 Polyclonal specifically detects TRAPPC1 in Human samples. It is validated for Western Blot.Specifications
| TRAPPC1 | |
| Polyclonal | |
| Rabbit | |
| Q2KMM2 | |
| 58485 | |
| Synthetic peptides corresponding to TRAPPC1 (trafficking protein particle complex 1) The peptide sequence was selected from the middle region of TRAPPC1)(50ug). Peptide sequence YKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYKLHYYETPTGIKVVM. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| BET5BET5 homolog, Multiple myeloma protein 2, MUM-2, MUM2melanoma ubiquitous mutated 2, trafficking protein particle complex 1, trafficking protein particle complex subunit 1 | |
| TRAPPC1 | |
| IgG | |
| This product is specific to Subunit or Isoform: 1. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title