missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Transglutaminase 7/TGM7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Transglutaminase 7/TGM7 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Transglutaminase 7/TGM7 Polyclonal specifically detects Transglutaminase 7/TGM7 in Human samples. It is validated for Western Blot.Specifications
| Transglutaminase 7/TGM7 | |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| protein-glutamine gamma-glutamyltransferase Z, TG(Z), TGase Z, TGase-7, TGMZEC 2.3.2.13, TGZ, transglutaminase 7, Transglutaminase Z, transglutaminase-7 | |
| TGM7 | |
| IgG | |
| 80 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q96PF1 | |
| 116179 | |
| Synthetic peptides corresponding to TGM7(transglutaminase 7) The peptide sequence was selected from the C terminal of TGM7. Peptide sequence TQKPFWRHTVRMNLDFGKETQWPLLLPYSNYRNKLTDEKLIRVSGIAEVE. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title