missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18381429

TRA2B Antibody (7A1), Novus Biologicals™

Product Code. 18381429 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18381429 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18381429 Supplier Novus Biologicals Supplier No. H00006434M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

TRA2B Monoclonal antibody specifically detects TRA2B in Human, Mouse samples. It is validated for Western Blot, ELISA, ELISA, KnockDown
TRUSTED_SUSTAINABILITY

Specifications

Antigen TRA2B
Applications Western Blot, ELISA, Sandwich ELISA, KnockDown
Classification Monoclonal
Clone 7A1
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_004584
Gene Alias DKFZp686F18120, hTRA2-beta, SFRS10, Splicing factor, arginine/serine-rich 10, splicing factor, arginine/serine-rich 10 (transformer 2 homolog, Drosophila), SRFS10, TRA-2 beta, TRA2-beta, TRAN2B, transformer 2 beta homolog (Drosophila), transformer 2 homolog, Transformer-2 protein homolog B, transformer-2 protein homolog beta, transformer-2-beta
Host Species Mouse
Immunogen SFRS10 (NP_004584, 120 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRP
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6434
Target Species Human, Mouse
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.