missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TR beta 1/NR1A2/Thyroid Hormone Receptor beta Rabbit anti-Human, Polyclonal, Novus Biologicals™
Shop All Bio Techne ProductsDescription
TR beta 1/NR1A2/Thyroid Hormone Receptor beta Polyclonal specifically detects TR beta 1/NR1A2/Thyroid Hormone Receptor beta in Human samples. It is validated for Western Blot, Chromatin Immunoprecipitation.
Specifications
Specifications
| Antigen | TR beta 1/NR1A2/Thyroid Hormone Receptor beta |
| Applications | ChIP Assay |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | avian erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, c-erbA-2, c-erbA-beta, ERBA2MGC126109, ERBA-BETA, GRTH, MGC126110, NR1A2thyroid hormone receptor, beta (avian erythroblastic leukemia viral (v-erb-a)oncogene homolog 2), Nuclear receptor subfamily 1 group A member 2, oncogene ERBA2, PRTH, THR1pituitary resistance to thyroid hormone, THRB1, THRB2, thyroid hormone receptor beta, thyroid hormone receptor beta 1, thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a)oncogene homolog 2, avian) |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TR beta 1/NR1A2/Thyroid Hormone Receptor beta (NP_000452). Peptide sequence MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLK |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?