missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TPX2 Antibody, Novus Biologicals™

TPX2 Antibody, Novus Biologicals™

Product Code. 18362651 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18362651 0.1 mL 0.1mL
18431631 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18362651 Supplier Novus Biologicals Supplier No. NBP188312

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody has been used in 1 publication

TPX2 Polyclonal specifically detects TPX2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen TPX2
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias C20orf1HCTP4, C20orf2, chromosome 20 open reading frame 1, Differentially expressed in cancerous and non-cancerous lung cells 2, differentially expressed in lung cells, DIL2, DIL-2FLS353, HCA519, Hepatocellular carcinoma-associated antigen 519, P100, p100GD:C20orf1, preferentially expressed in colorectal cancer, Protein fls353, REPP86, restricted expression proliferation associated protein 100, Restricted expression proliferation-associated protein 100, targeting protein for Xklp2, TPX2, microtubule-associated protein homolog, TPX2, microtubule-associated, homolog (Xenopus laevis)
Gene Symbols TPX2
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QELEKSMKMQQEVVEMRKKNEEFKKLALAGIGQPVKKSVSQVTKSVDFHFRTDERIKQHPKNQEEYKEVNFTSELRKHPSSPARVTKGCTIVKPFNLSQGKKRTFDETVSTYVPLAQQVEDFHKRTPNRYHLRSKKD
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cancer, Cell Biology, Cell Cycle and Replication, Chromatin Research, DNA Repair, Mitotic Regulators
Primary or Secondary Primary
Gene ID (Entrez) 22974
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.