missing translation for 'onlineSavingsMsg'
Learn More

TPD52L1/D53 Antibody, Novus Biologicals™

Product Code. 18376697 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18376697 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18376697 Supplier Novus Biologicals Supplier No. H00007164B02P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Polyclonal Antibody

TPD52L1/D53 Polyclonal antibody specifically detects TPD52L1/D53 in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen TPD52L1/D53
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. NP_003278.1
Gene Alias D53, MGC8556, tumor protein D52-like 1hD53TPD52L2, tumor protein D52-like 2, tumor protein D53
Host Species Mouse
Immunogen TPD52L1 (NP_003278.1, 1 a.a. - 204 a.a.) full-length human protein. MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPAMRNSPTFKSFEERVETTVTSLKTKVGGTNPNGGSFEEVLSSTAHASAQSLAGGSRRTKEEELQC
Purification Method IgG purified
Quantity 0.05 mg
Regulatory Status RUO
Research Discipline Apoptosis, Cancer, Cell Biology, Cell Cycle and Replication, Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 7164
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.