missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
TPD52 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Tekniske data
| Antigen | TPD52 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Beskrivelse
TPD52 Polyclonal specifically detects TPD52 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).Tekniske data
| TPD52 | |
| Unconjugated | |
| RUO | |
| P55327 | |
| 7163 | |
| Synthetic peptides corresponding to TPD52(tumor protein D52) The peptide sequence was selected from the middle region of TPD52. Peptide sequence AGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAG. | |
| Primary |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| D52, hD52, N8L, PC-1, PrLZ, prostate and colon associated protein, prostate leucine zipper, Protein N8, tumor protein D52 | |
| TPD52 | |
| IgG |
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel