missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TPD52 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | TPD52 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
TPD52 Polyclonal specifically detects TPD52 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).Specifications
| TPD52 | |
| Unconjugated | |
| RUO | |
| P55327 | |
| 7163 | |
| Synthetic peptides corresponding to TPD52(tumor protein D52) The peptide sequence was selected from the middle region of TPD52. Peptide sequence AGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAG. | |
| Primary |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| D52, hD52, N8L, PC-1, PrLZ, prostate and colon associated protein, prostate leucine zipper, Protein N8, tumor protein D52 | |
| TPD52 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title