missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TOX3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-86676-25ul
This item is not returnable.
View return policy
Description
TOX3 Polyclonal specifically detects TOX3 in Human samples. It is validated for Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| TOX3 | |
| Polyclonal | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| TOX3 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:SQGSEFTPQFPPQSLDLPSITISRNLVEQDGVLHSSGLHMDQSHTQVSQYRQDPSLIMRSIVHMTDAARSGVMP | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 0.2mg/mL | |
| Simple Western 5 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| CAG trinucleotide repeat-containing gene F9 protein, CAGF9trinucleotide repeat containing 9, TNRC9, TOX high mobility group box family member 3, Trinucleotide repeat-containing gene 9 protein | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 27324 | |
| Human | |
| IgG |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu