TOX3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-86676-25ul

Product Code. 18471091

Description

TOX3 Polyclonal specifically detects TOX3 in Human samples. It is validated for Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TOX3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: TOX3
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SQGSEFTPQFPPQSLDLPSITISRNLVEQDGVLHSSGLHMDQSHTQVSQYRQDPSLIMRSIVHMTDAARSGVMP
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.2mg/mL
• Dilution: Simple Western 5 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: CAG trinucleotide repeat-containing gene F9 protein, CAGF9trinucleotide repeat containing 9, TNRC9, TOX high mobility group box family member 3, Trinucleotide repeat-containing gene 9 protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 27324
• Target Species: Human
• Isotype: IgG

For Research Use Only