TORC2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-86925-25ul

Product Code. 18491981

Description

TORC2 Polyclonal antibody specifically detects TORC2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: TORC2
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: CREB regulated transcription coactivator 2, CREB-regulated transcription coactivator 2, TORC-2, TORC2transducer of regulated cAMP response element-binding protein (CREB) 2, Transducer of CREB protein 2, Transducer of regulated cAMP response element-binding protein 2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ALNRTSSDSALHTSVMNPSPQDTYPGPTPPSILPSRRGGILDGEMDPKVPAIEENLLDDKHLLKPWDAKKLSSSSSRPRSCEVPGIN
• Quantity: 25 μL
• Research Discipline: Cancer, Hypoxia, Lipid and Metabolism, Signal Transduction, Transcription Factors and Regulators
• Gene ID (Entrez): 200186
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified