TOPORS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-35863-100ul

Product Code. 30231803

Description

TOPORS Polyclonal antibody specifically detects TOPORS in Mouse,Rat samples. It is validated for ELISA,Western Blot

Specifications

• Antigen: TOPORS
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:2000, ELISA
• Gene Alias: EC 6.3.2.-, LUNtopoisomerase I binding, arginine/serine-rich, p53-binding protein 3, p53BP3, retinitis pigmentosa 31 (autosomal dominant), RP31, SUMO1-protein E3 ligase Topors, topoisomerase I binding, arginine/serine-rich, E3 ubiquitin protein ligase, Topoisomerase I-binding arginine/serine-rich protein, Topoisomerase I-binding RING finger protein, TP53BPLE3 ubiquitin-protein ligase Topors, Tumor suppressor p53-binding protein 3
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of mouse TOPORS (NP_598858.2).,, Sequence:, PDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFTNPEVRRFRYRTTMTRERSASLYSPSST
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Mouse, Rat
• Form: Purified

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10210
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG