Topoisomerase I Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-35246-20ul

Product Code. 30231252

Description

Topoisomerase I Polyclonal antibody specifically detects Topoisomerase I in Human,Mouse samples. It is validated for ELISA,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunohistochemistry (Paraffin)

Specifications

• Antigen: Topoisomerase I
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: DNA topoisomerase 1, DNA topoisomerase I, EC 5.99.1.2, TOPI, topoisomerase (DNA) I, type I DNA topoisomerase
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Topoisomerase I (Topoisomerase I (TOP1)) (NP_003277.1).,, Sequence:, MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDA
• Quantity: 20 μL
• Research Discipline: Cell Cycle and Replication, DNA Repair, DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 7150
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Purified