TOPAZ1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-30805

Product Code. 18146902

Description

TOPAZ1 Polyclonal specifically detects TOPAZ1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: C3orf77
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q8N9V7
• Gene Symbols: TOPAZ1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KSDTNSIPQLLQTEENVMGVNKLLPEESDLYQSKTNGLLSCLQHEKNKYSIEESSVGRKPRKRMKLSEKADETVTEMNFSNEYNKSELMLQENQM
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Chromosome 3 Open Reading Frame 77, Testis And Ovary Specific PAZ Domain Containing 1, Testis And Ovary-Specific PAZ Domain Gene 1, Testis- And Ovary-Specific PAZ Domain-Containing Protein 1, Topaz 1, TOPAZ1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 375337
• Target Species: Human
• Isotype: IgG

For Research Use Only