missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TOMM6 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93442-0.1ml
This item is not returnable.
View return policy
Description
TOMM6 Polyclonal antibody specifically detects TOMM6 in Mouse samples. It is validated for Western Blot
Specifications
| TOMM6 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| FLJ32622, mitochondrial import receptor subunit TOM6 homolog, over-expressed breast tumor protein, TOM6, translocase of outer membrane 6 kDa subunit homolog, translocase of outer mitochondrial membrane 6 homolog (yeast) | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-74 of human TOMM6 (NP_001127965.1). MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLARNLSDIDLMAPQPGV | |
| 0.1 mL | |
| Endocrinology | |
| 100188893 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction