missing translation for 'onlineSavingsMsg'
Learn More

TOM70 Antibody, Novus Biologicals™

Product Code. 18432812 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18432812 25 μL 25µL
18701554 - 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18432812 Supplier Novus Biologicals Supplier No. NBP18786325ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody has been used in 2 publications

TOM70 Polyclonal specifically detects TOM70 in Human, Mouse samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen TOM70
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Simple Western, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias FLJ90470, KIAA0719, mitochondrial import receptor subunit TOM70, Mitochondrial precursor proteins import receptor, TOM70, Translocase of outer membrane 70 kDa subunit, translocase of outer mitochondrial membrane 70 (yeast) homolog A, translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae), translocase of outer mitochondrial membrane 70 homolog A (yeast)
Gene Symbols TOMM70
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PLLSTQDFNMAADIDPQNADVYHHRGQLKILLDQVEEAVADFDECIRLRPESALAQAQKCFALYRQAYTGNNSSQIQAAMKGFEEVIKKFPRCAEGYALYAQALTDQQQFGKADEMYDKCIDLEPDNATT
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Apoptosis, Cellular Markers, Mitochondrial Markers, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 9868
Test Specificity Specificity of human TOM70 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.