missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TOB1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | TOB1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TOB1 Polyclonal specifically detects TOB1 in Human samples. It is validated for Western Blot.Specifications
| TOB1 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| APRO6, MGC104792, PIG49, protein Tob1, TOBMGC34446, Transducer of erbB-2 1, transducer of ERBB2, 1, TROB, TROB1 | |
| TOB1 | |
| IgG | |
| 38 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_005740 | |
| 10140 | |
| Synthetic peptide directed towards the middle region of human TOB1The immunogen for this antibody is TOB1. Peptide sequence DLLKQKAISSSMHSLYGLGLGSQQQPQQQQQPAQPPPPPPPPQQQQQQKT. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title