missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TNNI3K Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£149.00 - £366.00
Specifications
| Antigen | TNNI3K |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18641542
|
Novus Biologicals
NBP2-94172-0.02ml |
0.02 mL |
£149.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18621892
|
Novus Biologicals
NBP2-94172-0.1ml |
0.1 mL |
£366.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TNNI3K Polyclonal antibody specifically detects TNNI3K in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| TNNI3K | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Protein Kinase | |
| PBS (pH 7.3), 50% glycerol | |
| 51086 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| CARKCardiac ankyrin repeat kinase, EC 2.7.11.1, MGC142099, MGC33828, serine/threonine-protein kinase TNNI3K, TNNI3 interacting kinase, TNNI3-interacting kinase | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-75 of human TNNI3K (NP_057062.1). MGNYKSRPTQTCTDEWKKKVSESYVITIERLEDDLQIKEKELTELRNIFGSDEAFSKVNLNYRTENGLSLLHLCC | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title