Abnova™ TNNC2 Recombinant Protein

Product Code. 16121472

Brand: Abnova™ H00007125P01.10ug

Description

Human TNNC2 full-length ORF (AAH05323, 1 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal

Troponin (Tn), a key protein complex in the regulation of striated muscle contraction, is composed of 3 subunits. The Tn-I subunit inhibits actomyosin ATPase, the Tn-T subunit binds tropomyosin and Tn-C, while the Tn-C subunit binds calcium and overcomes the inhibitory action of the troponin complex on actin filaments. The protein encoded by this gene is the Tn-C subunit.

• Troponin C type 2 (fast)
• Molecular weight: 43.34kDa
• Preparation method: in vitro wheat germ expression system
• Purification: Glutathione Sepharose 4 Fast Flow
• Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH 8 in the elution buffer
• Quality Control Testing: 12.5% SDS-PAGE stained with Coomassie Blue

Sequence:
MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ

Best use within three months from the date of receipt of this protein.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

• Accession Number: AAH05323
• For Use With (Application): Antibody Production, Protein Array, ELISA, Western Blot
• Formulation: 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
• Gene ID (Entrez): 7125
• Molecular Weight (g/mol): 43.34
• Name: TNNC2 (Human) Recombinant Protein (P01)
• pH Range: 8
• Preparation Method: In vitro wheat germ expression system
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 10 μg
• Source: Wheat Germ (in vitro)
• Immunogen: MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Common Name: TNNC2
• Gene Symbol: TNNC2
• Cross Reactivity: Human
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Form: Solution