missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Tmp21/p23 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-47600-25ul
This item is not returnable.
View return policy
Description
Tmp21/p23 Polyclonal specifically detects Tmp21/p23 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| Tmp21/p23 | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| 21 kDa transmembrane-trafficking protein, p23, P24(DELTA), p24delta, S31I125, S31III125, TMP21Tmp-21-I, transmembrane emp24 domain-containing protein 10, transmembrane emp24-like trafficking protein 10 (yeast), Transmembrane protein Tmp21,21 kDa transmembrane trafficking protein | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| TMED10 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MFEVCFESKGTGRIPDQLVILDMKHGVEAKNYEEIAKVEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTN | |
| 25 μL | |
| Alzheimers Research, Neurodegeneration, Neuroscience, Signal Transduction | |
| 10972 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction