Tmp21/p23 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-47600

Product Code. 18117437

Description

Tmp21/p23 Polyclonal specifically detects Tmp21/p23 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Tmp21/p23
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: 21 kDa transmembrane-trafficking protein, p23, P24(DELTA), p24delta, S31I125, S31III125, TMP21Tmp-21-I, transmembrane emp24 domain-containing protein 10, transmembrane emp24-like trafficking protein 10 (yeast), Transmembrane protein Tmp21,21 kDa transmembrane trafficking protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: TMED10
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MFEVCFESKGTGRIPDQLVILDMKHGVEAKNYEEIAKVEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTN
• Quantity: 0.1 mL
• Research Discipline: Alzheimers Research, Neurodegeneration, Neuroscience, Signal Transduction
• Gene ID (Entrez): 10972
• Target Species: Human
• Isotype: IgG

For Research Use Only