missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TMEM91 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | TMEM91 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TMEM91 Polyclonal specifically detects TMEM91 in Human samples. It is validated for Western Blot.Specifications
| TMEM91 | |
| Polyclonal | |
| Rabbit | |
| IFITMD6, interferon induced transmembrane protein domain containing 6, transmembrane protein 91 | |
| TMEM91 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 641649 | |
| Synthetic peptides corresponding to TMEM91(transmembrane protein 91) The peptide sequence was selected from the N terminal of TMEM91. Peptide sequence MDSPSLRELQQPLLEGTECETPAQKPGRHELGSPLREIAFAESLRGLQFL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title