missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TMEM30B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | TMEM30B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TMEM30B Polyclonal specifically detects TMEM30B in Human samples. It is validated for Western Blot.Specifications
| TMEM30B | |
| Polyclonal | |
| Rabbit | |
| Q3MIR4 | |
| 161291 | |
| Synthetic peptides corresponding to TMEM30B(transmembrane protein 30B) The peptide sequence was selected from the middle region of TMEM30B. Peptide sequence VYLYYELTNFYQNNRRYGVSRDDAQLSGLPSALRHPVNECAPYQRSAAGL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| cell cycle control protein 50B, transmembrane protein 30BCDC50BMGC126775 | |
| TMEM30B | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title