missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TMEM177 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £470.00
Specifications
| Antigen | TMEM177 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18221464
|
Novus Biologicals
NBP2-55482 |
100 μL |
£470.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18627766
|
Novus Biologicals
NBP2-55482-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TMEM177 Polyclonal specifically detects TMEM177 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| TMEM177 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| MGC10993, transmembrane protein 177 | |
| TMEM177 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 80775 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VVQWLYQYWPQGQPAPLPPQLQSLFQEVLQDIGVPSGHCYKPFTTFTFQPVSAGFPRLPAG | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto