missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TMEM132D Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | TMEM132D |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TMEM132D Polyclonal specifically detects TMEM132D in Mouse samples. It is validated for Western Blot.Specifications
| TMEM132D | |
| Polyclonal | |
| Rabbit | |
| NP_766473 | |
| 121256 | |
| The specific Immunogen is proprietary information. Peptide sequence QRPKQEAAISCWVQFSDGSVTPLDIYDEKDFSLMATSLDEKVVSILQDPK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| HBE120, KIAA1944, mature OL transmembrane protein, mature oligodendrocytes transmembrane protein, MGC138770, MGC138771, MOLT, transmembrane protein 132D | |
| TMEM132D | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title