missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
TLX/NR2E1 Monoclonal antibody specifically detects TLX/NR2E1 in Human,Mouse samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | TLX/NR2E1 |
| Applications | ELISA, Western Blot |
| Classification | Monoclonal |
| Clone | 1C4 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_003260 |
| Gene Alias | hTll, nuclear receptor subfamily 2, group E, member 1, Nuclear receptor TLX, Protein tailless homolog, tailes-related receptor, tailless homolog, Tll, TLXnuclear receptor subfamily 2 group E member 1, XTLL |
| Host Species | Mouse |
| Immunogen | NR2E1 (NP_003260, 249 a.a. ∽ 342 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NGDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGK |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?