missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TL1A/TNFSF15 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-58139
This item is not returnable.
View return policy
Description
TL1A/TNFSF15 Polyclonal specifically detects TL1A/TNFSF15 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| TL1A/TNFSF15 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| MGC129934, MGC129935, TL1A, TL1Vascular endothelial cell growth inhibitor, TNF superfamily ligand TL1A, tumor necrosis factor (ligand) superfamily, member 15, tumor necrosis factor ligand superfamily member 15, vascular endothelial growth inhibitor-192A, VEGI192A, VEGITNF ligand-related molecule 1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| TNFSF15 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQ | |
| 100 μL | |
| Apoptosis, Cell Cycle and Replication | |
| 9966 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction