missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Tissue alpha-L-Fucosidase/FUCA1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Tissue alpha-L-Fucosidase/FUCA1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Tissue alpha-L-Fucosidase/FUCA1 Polyclonal specifically detects Tissue alpha-L-Fucosidase/FUCA1 in Human samples. It is validated for Western Blot.Specifications
| Tissue alpha-L-Fucosidase/FUCA1 | |
| Polyclonal | |
| Rabbit | |
| P04066 | |
| 2517 | |
| Synthetic peptides corresponding to FUCA1(fucosidase, alpha-L- 1, tissue) The peptide sequence was selected from the middle region of FUCA1. Peptide sequence TNWPSPVSWNWNSKDVGPHRDLVGELGTALRKRNIRYGLYHSLLEWFHPL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Alpha-L-fucosidase 1, Alpha-L-fucosidase I, Alpha-L-fucoside fucohydrolase 1, EC 3.2.1, EC 3.2.1.51, FUCA, fucosidase, alpha-L- 1, tissue, tissue alpha-L-fucosidase | |
| FUCA1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title