missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TIPRL Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | TIPRL |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18217584
|
Novus Biologicals
NBP2-55024 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18605417
|
Novus Biologicals
NBP2-55024-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TIPRL Polyclonal specifically detects TIPRL in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| TIPRL | |
| Polyclonal | |
| Rabbit | |
| Human | |
| dJ69E11.3, MGC3794, putative MAPK activating protein, Putative MAPK-activating protein PM10, TIP41, TOR signaling pathway regulator-like (S. cerevisiae), TIP41-like protein, TIP41Type 2A-interacting protein, TIPTIP41, TOR signalling pathway regulator-like (S. cerevisiae) | |
| TIPRL | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 261726 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RIDGVLIRMNDTRLYHEADKTYMLREYTSRESKISSLMHVPPSLFTEPNEISQYLPIKEAVCEKLI | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts