missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TIP120A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | TIP120A |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18637195
|
Novus Biologicals
NBP2-38974-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18121169
|
Novus Biologicals
NBP2-38974 |
0.1 mL |
£513.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TIP120A Polyclonal specifically detects TIP120A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| TIP120A | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q86VP6 | |
| 55832 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: QTRPVQSWLCDPDAMEQGETPLTMLQSQVPNIVKALHKQMKEKSVKTRQCCFNMLTELVNVLPG | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| cullin-associated and neddylation-dissociated 1, Cullin-associated and neddylation-dissociated protein 1, cullin-associated NEDD8-dissociated protein 1, DKFZp434M1414, FLJ90441, KIAA0829FLJ10114, p120 CAND1, TBP interacting protein, TBP-interacting protein 120A, TBP-interacting protein of 120 kDa A, TIP120AFLJ38691, TIP120FLJ10929 | |
| CAND1 | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title