TINAGL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18453362	Novus Biologicals NBP2-13434-25ul	25ul
18056309	Novus Biologicals NBP2-13434	0.1 mL

Description

TINAGL1 Polyclonal specifically detects TINAGL1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TINAGL1
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: androgen-regulated gene 1, ARG1, GIS5, Glucocorticoid-inducible protein 5, LCN7, LIECG3, lipocalin 7, OLRG2, OLRG-2, Oxidized LDL-responsive gene 2 protein, oxidized-LDL responsive gene 2, P3ECSL, TIN Ag-related protein, TINAGL, TINAG-like 1, TIN-Ag-RP, TINAGRP, tubulointerstitial nephritis antigen-like, tubulointerstitial nephritis antigen-like 1, Tubulointerstitial nephritis antigen-related protein
• Gene Symbols: TINAGL1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50-1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Signal Transduction
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 64129
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: DQEPCLVDPDMIKAINQGNYGWQAGNHSAFWGMTLDEGIRYRLGTIRPSSSVMNMHEIYTVLNPGEVLPTAFEASEKWPNLI
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only