missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
TIMM8B Monoclonal antibody specifically detects TIMM8B in Human samples. It is validated for Western Blot,ELISA
Specifications
Specifications
| Antigen | TIMM8B |
| Applications | Western Blot, ELISA |
| Classification | Monoclonal |
| Clone | 8E5 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_036591 |
| Gene Alias | DDP2DDP-like protein, DDPL, Deafness dystonia protein 2, FLJ21744, MGC102866, MGC117373, mitochondrial import inner membrane translocase subunit Tim8 B, TIM8Btranslocase of inner mitochondrial membrane 8 (yeast) homolog B, translocase of inner mitochondrial membrane 8 homolog B (yeast) |
| Host Species | Mouse |
| Immunogen | TIMM8B (NP_036591.1, 1 a.a. ∽ 83 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGGQ |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?