missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18348159

Novus Biologicals™ TIMM8B Antibody (8E5), Novus Biologicals™

Product Code. 18348159 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18348159 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18348159 Supplier Novus Biologicals™ Supplier No. H00026521M15

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

TIMM8B Monoclonal antibody specifically detects TIMM8B in Human samples. It is validated for Western Blot,ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen TIMM8B
Applications Western Blot, ELISA
Classification Monoclonal
Clone 8E5
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_036591
Gene Alias DDP2DDP-like protein, DDPL, Deafness dystonia protein 2, FLJ21744, MGC102866, MGC117373, mitochondrial import inner membrane translocase subunit Tim8 B, TIM8Btranslocase of inner mitochondrial membrane 8 (yeast) homolog B, translocase of inner mitochondrial membrane 8 homolog B (yeast)
Host Species Mouse
Immunogen TIMM8B (NP_036591.1, 1 a.a. ∽ 83 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGGQ
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 26521
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.