missing translation for 'onlineSavingsMsg'
Learn More

TIMM8A Antibody, Novus Biologicals™

Product Code. 18409220 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18409220 25 μL 25µL
18280826 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18409220 Supplier Novus Biologicals Supplier No. NBP18428825ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

TIMM8A Polyclonal specifically detects TIMM8A in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen TIMM8A
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. O60220
Gene Alias DDP1deafness/dystonia peptide, DDPMGC12262, Deafness dystonia protein 1, DFN1, mitochondrial import inner membrane translocase subunit Tim8 A, MTSTIM8, TIM8A, translocase of inner mitochondrial membrane 8 (yeast) homolog A, translocase of inner mitochondrial membrane 8 homolog A (yeast), X-linked deafness dystonia protein
Gene Symbols TIMM8A
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSK
Molecular Weight of Antigen 11 kDa
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Neuroscience, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 1678
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.