TIMM8A Antibody (1A12), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00001678-M04

Product Code. 18391478

Description

TIMM8A Monoclonal antibody specifically detects TIMM8A in Human samples. It is validated for Western Blot, ELISA, ELISA

Specifications

• Antigen: TIMM8A
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: In 1x PBS, pH 7.4
• Gene Alias: DDP1deafness/dystonia peptide, DDPMGC12262, Deafness dystonia protein 1, DFN1, mitochondrial import inner membrane translocase subunit Tim8 A, MTSTIM8, TIM8A, translocase of inner mitochondrial membrane 8 (yeast) homolog A, translocase of inner mitochondrial membrane 8 homolog A (yeast), X-linked deafness dystonia protein
• Immunogen: TIMM8A (AAH05236, 1 a.a. ~ 72 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLLNDKWVNEEIKKKIEKCLETNDNGNTTYQNLWDTAKAVVRGKFIAISTYIKKEEKLQINNLTMNLIELEN
• Quantity: 0.1 mg
• Research Discipline: Core ESC Like Genes, Neuroscience, Stem Cell Markers
• Gene ID (Entrez): 1678
• Content And Storage: Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
• Isotype: IgG2a κ

• Applications: Western Blot, ELISA, Sandwich ELISA
• Clone: 1A12
• Dilution: Western Blot 1:500, ELISA, Sandwich ELISA
• Gene Accession No.: BC005236
• Host Species: Mouse
• Purification Method: IgG purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified