missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TIMM23 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-09960-100UL
This item is not returnable.
View return policy
Description
TIMM23 Polyclonal specifically detects TIMM23 in Human samples. It is validated for Western Blot, Adhesion Activation.
Specifications
| TIMM23 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml, Adhesion Activation | |
| bA592B15.7, MGC22767, PRO1197, RP11-592B15.7, TIM23 | |
| The immunogen is a synthetic peptide directed towards the C terminal region of human TIMM23 (NP_006318.1). Peptide sequence VAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQ | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot, Adhesion Activation | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 100287932 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction