missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TIMM17B Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33481-20ul
This item is not returnable.
View return policy
Description
TIMM17B Monoclonal antibody specifically detects TIMM17B in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| TIMM17B | |
| Monoclonal | |
| Western Blot 1:1000 - 1:5000, ELISA Recommended starting concentration is 1 μg/mL | |
| inner mitochondrial membrane preprotein translocase, JM3, mitochondrial import inner membrane translocase subunit Tim17-B, TIM17BDXS9822, translocase of inner mitochondrial membrane 17 homolog B (yeast) | |
| A synthetic peptide corresponding to a sequence within amino acids 60-160 of human TIMM17B (NP_005825.1).,, Sequence:, PQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGT | |
| 20 μL | |
| Endocrinology | |
| 10245 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction