missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TIMM10 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93176-0.1ml
This item is not returnable.
View return policy
Description
TIMM10 Polyclonal antibody specifically detects TIMM10 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| TIMM10 | |
| Polyclonal | |
| Western Blot 1:1000 - 1:5000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 | |
| mitochondrial import inner membrane translocase subunit Tim10, TIM10TIM10Atranslocase of inner mitochondrial membrane 10 (yeast) homolog, translocase of inner mitochondrial membrane 10 homolog (yeast) | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human TIMM10 (NP_036588.1). MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPA | |
| 0.1 mL | |
| Endocrinology, Signal Transduction | |
| 26519 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction