missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Tight Junction Protein 2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 4 publications
£280.00 - £460.00
Specifications
| Antigen | Tight Junction Protein 2 |
|---|---|
| Dilution | Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL, Immunoprecipitation -Validated from a verified customer review, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18484431
|
Novus Biologicals
NBP1-86850-25ul |
25 μL |
£280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18707603
|
Novus Biologicals
NBP1-86850 |
0.1 mL |
£460.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Tight Junction Protein 2 Polyclonal specifically detects Tight Junction Protein 2 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin.Specifications
| Tight Junction Protein 2 | |
| Polyclonal | |
| Rabbit | |
| PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
| 9414 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:IGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQLVVLRDSQQTLINIPSLNDSDSEIEDISEIESNRSFSPEERRHQYSDYDYHSSSEKLKERPSSREDTPSRLSRMG | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL, Immunoprecipitation -Validated from a verified customer review, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Unconjugated | |
| RUO | |
| C9DUPq21.11, DFNA51, DUP9q21.11, MGC26306, Tight junction protein 2, tight junction protein 2 (zona occludens 2), TJP2, X104, X104tight junction protein ZO-2, ZO2, ZO-2, ZO2Friedreich ataxia region gene X104 (tight junction protein ZO-2), Zona occludens protein 2, Zonula occludens protein 2 | |
| TJP2 | |
| IgG | |
| Affinity Purified | |
| Specificity of human Tight Junction Protein 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title