missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TIGD4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | TIGD4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TIGD4 Polyclonal specifically detects TIGD4 in Mouse samples. It is validated for Western Blot.Specifications
| TIGD4 | |
| Polyclonal | |
| Rabbit | |
| Q8BUZ3 | |
| 201798 | |
| Synthetic peptides corresponding to the N terminal of Tigd4. Immunizing peptide sequence LRLKANDFAQKLGHNDFKCSNGWLDRFKSRYGLVFRAQPVEATGISIDPS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| MGC43837, tigger transposable element derived 4, tigger transposable element-derived protein 4 | |
| TIGD4 | |
| IgG | |
| 56 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title