missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TIF1 alpha Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £488.00
Specifications
| Antigen | TIF1 alpha |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence, KnockDown |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18260724
|
Novus Biologicals
NBP2-56418 |
100 μL |
£488.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18629718
|
Novus Biologicals
NBP2-56418-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Descripción
TIF1 alpha Polyclonal specifically detects TIF1 alpha in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence, Knockdown Validated.Especificaciones
| TIF1 alpha | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase, Zinc Finger | |
| E3 ubiquitin-protein ligase TRIM24, EC 6.3.2, EC 6.3.2.-, hTIF1, PTC6, RING finger protein 82, RNF82Tif1a, TIF1-alpha, TIF1ATIF1ALPHA, TIF1TF1A, transcription intermediary factor 1-alpha, transcriptional intermediary factor 1, tripartite motif containing 24, tripartite motif-containing 24, Tripartite motif-containing protein 24 | |
| TRIM24 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence, KnockDown | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 8805 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPKPEFRNESEDNKFSDDSDDDFVQPRKKRLKSIEERQLLK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto