missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TIF1 alpha Antibody, Novus Biologicals™

TIF1 alpha Antibody, Novus Biologicals™

Product Code. 18405191 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18405191 25 μL 25µL
18098806 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18405191 Supplier Novus Biologicals Supplier No. NBP19250625ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody has been used in 1 publication

TIF1 alpha Polyclonal specifically detects TIF1 alpha in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.
TRUSTED_SUSTAINABILITY

Specifications

Antigen TIF1 alpha
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:20 - 1:50, Knockdown Validated
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias E3 ubiquitin-protein ligase TRIM24, EC 6.3.2, EC 6.3.2.-, hTIF1, PTC6, RING finger protein 82, RNF82Tif1a, TIF1-alpha, TIF1ATIF1ALPHA, TIF1TF1A, transcription intermediary factor 1-alpha, transcriptional intermediary factor 1, tripartite motif containing 24, tripartite motif-containing 24, Tripartite motif-containing protein 24
Gene Symbols TRIM24
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SSPVGGSYNLPSLPDIDCSSTIMLDNIVRKDTNIDHGQPRPPSNRTVQSPNSSVPSPGLAGPVTMTSVHPPIRSPSA
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Protein Kinase, Zinc Finger
Primary or Secondary Primary
Gene ID (Entrez) 8805
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.