missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TICRR Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £486.00
Specifications
| Antigen | TICRR |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18002664
|
Novus Biologicals
NBP2-58491 |
100 μL |
£486.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18654639
|
Novus Biologicals
NBP2-58491-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TICRR Polyclonal specifically detects TICRR in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| TICRR | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 90381 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DIGVVEESPEKGDEISLRRSPRIKQLSFSRTHSASFYSVSQPKSRSVQRVHSFQQDKSDQRENSPVQSIRSPKSLLFGAMSEMISPSE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| C15orf42, Chromosome 15 Open Reading Frame 42, SLD3, SLD3 Homolog, SLD3 Homolog (S. Cerevisiae), TOPBP1-Interacting Checkpoint And Replication Regulator, TOPBP1-Interacting Replication-Stimulating Protein, TopBP1-Interacting, Replication-Stimulating Protein, Treslin | |
| TICRR | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title