TIA1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-54962

Product Code. 18285381

Description

TIA1 Polyclonal specifically detects TIA1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: TIA1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: cytotoxic granule-associated RNA-binding protein, nucleolysin TIA-1 isoform p40, p40-TIA-1, p40-TIA-1 (containing p15-TIA-1), RNA-binding protein TIA-1, T-cell-restricted intracellular antigen-1, TIA-1, TIA1 cytotoxic granule-associated RNA binding protein, TIA1 cytotoxic granule-associated RNA-binding protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: TIA1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRV
• Quantity: 100 μL
• Research Discipline: Adaptive Immunity, Apoptosis, Immunology
• Gene ID (Entrez): 7072
• Target Species: Human
• Isotype: IgG

For Research Use Only