missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Thyrotropin Releasing Hormone Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94348-0.1ml
This item is not returnable.
View return policy
Description
Thyrotropin Releasing Hormone Polyclonal antibody specifically detects Thyrotropin Releasing Hormone in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| Thyrotropin Releasing Hormone | |
| Polyclonal | |
| Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
| MGC125964, MGC125965, prothyroliberin, thyrotropin-releasing hormone | |
| A synthetic peptide corresponding to a sequence within amino acids 143-242 of human Thyrotropin Releasing Hormone (NP_009048.1). WLAYAVPKRQHPGRRLADPKAQRSWEEEEEEEEREEDLMPEKRQHPGKRALGGPCGPQGAYGQAGLLLGLLDDLSRSQGAEEKRQHPGRRAAWVREPLEE | |
| 0.1 mL | |
| Signal Transduction | |
| 7200 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction