missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Thyroid Peroxidase Antibody, Novus Biologicals™

Thyroid Peroxidase Antibody, Novus Biologicals™

Product Code. 30227168 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30227168 100 μL 100µL
30232754 20 μL 20µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 30227168 Supplier Novus Biologicals Supplier No. NBP333200100ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Monoclonal Antibody

Thyroid Peroxidase Monoclonal antibody specifically detects Thyroid Peroxidase in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Thyroid Peroxidase
Applications ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Conjugate Unconjugated
Dilution ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.3), 50% glycerol, 0.05% BSA
Gene Alias EC 1.11.1, MSA, TDH2A, thyroid microsomal antigen, thyroid peroxidase, thyroperoxidase, TPXEC 1.11.1.8
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Thyroid Peroxidase (P07202).,, Sequence:, MRALAVLSVTLVMACTEAFFPFISRGKELLWGKPEESRVSSVLEESKRLVDTAMYATMQRNLKKRGILSPAQLLSFSKLPEPTSGVIARAAEIMETSIQA
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 7173
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.