missing translation for 'onlineSavingsMsg'
Learn More

Thymosin beta 4 Antibody (4H7), Novus Biologicals™

Product Code. 18369097 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18369097 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18369097 Supplier Novus Biologicals Supplier No. H00007114M03100ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

Thymosin beta 4 Monoclonal antibody specifically detects Thymosin beta 4 in Human, Rat samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Thymosin beta 4
Applications Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone 4H7
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_066932
Gene Alias PTMB4, T beta-4, TB4, TB4Xbeta 4, X chromosome, THYB4, thymosin beta 4, X-linked, thymosin beta-4
Host Species Mouse
Immunogen TMSB4X (NP_066932, 1 a.a. ~ 44 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Purification Method Protein A or G purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Biologically Active Proteins
Primary or Secondary Primary
Gene ID (Entrez) 7114
Target Species Human, Rat
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.