missing translation for 'onlineSavingsMsg'
Learn More

Thymidylate Synthase Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18393543 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18393543 100 μg 100µL
18355246 25 μg 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18393543 Supplier Bio-Techne Supplier No. NBP317004100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Thymidylate Synthase Polyclonal antibody specifically detects Thymidylate Synthase in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Thymidylate Synthase
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04 to 0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias EC 2.1.1.45, HsT422, MGC88736, thymidylate synthase, thymidylate synthetase, TMSTsase, TSase, TSHST422
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: SSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDD
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cancer, Cell Cycle and Replication, DNA Repair, DNA replication Transcription Translation and Splicing, Transcription Factors and Regulators, Translation Control
Primary or Secondary Primary
Gene ID (Entrez) 7298
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.