missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Thromboxane A2 R/TBXA2R Rabbit anti-Human, Polyclonal, Novus Biologicals™
Shop All Bio Techne ProductsDescription
Thromboxane A2 R/TBXA2R Polyclonal specifically detects Thromboxane A2 R/TBXA2R in Human samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | Thromboxane A2 R/TBXA2R |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | Prostanoid TP receptor, thromboxane A2 receptor, TXA2-R |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human Thromboxane A2 R/TBXA2R (NP_001051.1). Peptide sequence EYSGAISAHCNLRLPGSSDSSASACQVAGTTGTRPSWMQPPCLPSRWWAS |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?