THG1L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-82315

Product Code. 18258255

Description

THG1L Polyclonal specifically detects THG1L in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: THG1L
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:500, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:10-1:20
• Gene Alias: EC 2.7.7, EC 2.7.7.6, FLJ11601, FLJ20546, ICF45EC 2.7.7.-, Interphase cytoplasmic foci protein 45, probable tRNA(His) guanylyltransferase, tRNA-histidine guanylyltransferase, tRNA-histidine guanylyltransferase 1-like (S. cerevisiae)
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: THG1L
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:FEDQPLLYPPGFDGRVVVYPSNQTLKDYLSWRQADCHINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAAD
• Quantity: 0.1 mL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 54974
• Target Species: Human
• Isotype: IgG

For Research Use Only