missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
THEM4 Polyclonal antibody specifically detects THEM4 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | THEM4 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Gene Alias | C-terminal modulator protein, CTMPCarboxyl-terminal modulator protein, MGC29636, thioesterase superfamily member 4 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 37-150 of human THEM4 (NP_444283.2). SSEEVILKDCSVPNPSWNKDLRLLFDQFMKKCEDGSWKRLPSYKRTPTEWIQDFKTHFLDPKLMKEEQMSQAQLFTRSFDDGLGFEYVMFYNDIEKRMVCLFQGGPYLEGPPGF |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?